PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 462893644
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis
Family MYB
Protein Properties Length: 224aa    MW: 25268.5 Da    PI: 9.1352
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
462893644genomeTefView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.36.3e-1796140348
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +WT  Ed +l   v+++G ++Wk I ++++ gR +kqc++rw++yl
        462893644  96 SWTRVEDNILRSMVERYGEHNWKMIEQHLP-GRIGKQCRDRWNNYL 140
                      7*****************************.**************7 PP

2Myb_DNA-binding61.12.3e-19150190445
                      S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                      WT++Ed+ l++a++++Gg++W++Iar+++ gR+++ +k++w+
        462893644 150 WTEDEDKMLIEAHRRYGGNRWSKIARHLP-GRSENAIKNHWN 190
                      *****************************.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.12489140IPR017930Myb domain
SMARTSM007171.6E-1493142IPR001005SANT/Myb domain
SuperFamilySSF466893.95E-2995189IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.1E-2195143IPR009057Homeodomain-like
CDDcd001675.38E-1596140No hitNo description
PfamPF002492.1E-1596140IPR001005SANT/Myb domain
PROSITE profilePS5129423.93141197IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.7E-21144194IPR009057Homeodomain-like
SMARTSM007176.0E-17146195IPR001005SANT/Myb domain
CDDcd001672.92E-17150193No hitNo description
PfamPF002499.4E-17150190IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 224 aa     Download sequence    Send to blast
MAMEYLGSSG HGVTHFQNSM APVSVQASED QLTSVPVDAS SLVPRIGMTP TEFEMPDGAL  60
GVTGFDVVGG VPGEAMIAWQ PQNGSYGKPP APLETSWTRV EDNILRSMVE RYGEHNWKMI  120
EQHLPGRIGK QCRDRWNNYL RPGIKKNDFW TEDEDKMLIE AHRRYGGNRW SKIARHLPGR  180
SENAIKNHWN ATLRSLKTKR RPNNNMRANT QSTCAACAWL TTYL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A6e-34971947102MYB PROTO-ONCOGENE PROTEIN
1h88_C9e-349019454156MYB PROTO-ONCOGENE PROTEIN
1h89_C9e-349019454156MYB PROTO-ONCOGENE PROTEIN
1mse_C5e-34971947102C-Myb DNA-Binding Domain
1msf_C5e-34971947102C-Myb DNA-Binding Domain
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004972257.14e-72PREDICTED: uncharacterized protein LOC101784221
TrEMBLK3XS584e-72K3XS58_SETIT; Uncharacterized protein
STRINGSi004755m1e-71(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP188233101
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G18770.16e-37myb domain protein 98